Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STX17 Protein

This Human STX17 Protein spans the amino acid sequence from region 2-302aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P56962

Expression Region

2-302aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQKMMEKLTSSCPDLPSQTDKKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf42 Protein Vector (Human) (pPB-C-His)
PV049497 500 ng

C12orf42 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-CAP1 Antibody Picoband® (iFluor647 Conjugate)
PB9923-iFluor647 100 µg

Anti-CAP1 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glucosidase Beta, Acid (GbA)
MBS2066300-01 0.1 mL

APC-Linked Polyclonal Antibody to Glucosidase Beta, Acid (GbA)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glucosidase Beta, Acid (GbA)
MBS2066300-02 0.2 mL

APC-Linked Polyclonal Antibody to Glucosidase Beta, Acid (GbA)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glucosidase Beta, Acid (GbA)
MBS2066300-03 0.5 mL

APC-Linked Polyclonal Antibody to Glucosidase Beta, Acid (GbA)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glucosidase Beta, Acid (GbA)
MBS2066300-04 1 mL

APC-Linked Polyclonal Antibody to Glucosidase Beta, Acid (GbA)

Sign In for Pricing
View Details