Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCNK13 Protein

This Human KCNK13 Protein spans the amino acid sequence from region 1-408aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Tandem pore domain halothane-inhibited potassium channel 1) (THIK-1)

UniProt

Q9HB14

Expression Region

1-408aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nif3l1 Mouse shRNA Plasmid (Locus ID 65102)
TL503489 1 Kit

Nif3l1 Mouse shRNA Plasmid (Locus ID 65102)

Sign In for Pricing
View Details
Recombinant Human NMD3 Protein, N-His
orb2833728-01 20 µg

Recombinant Human NMD3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NMD3 Protein, N-His
orb2833728-02 50 µg

Recombinant Human NMD3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NMD3 Protein, N-His
orb2833728-03 100 µg

Recombinant Human NMD3 Protein, N-His

Sign In for Pricing
View Details
Urea
35940-65 500 g

Urea

Sign In for Pricing
View Details
Bckdha-set siRNA/shRNA/RNAi Lentivector (Mouse)
13219094 4x 500 ng

Bckdha-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details