Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RSPO1 Protein

This Human RSPO1 Protein spans the amino acid sequence from region 31-263aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Roof plate-specific spondin-1) (hRspo1)

UniProt

Q2MKA7

Expression Region

31-263aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5, the EC50 is 124.0-174.1 ng/mL.

Form

Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam18 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3823704 1.0 µg DNA

Adam18 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
SOX2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb969444 100 µL

SOX2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
1- (5-Bromopyrimidin-2-yl) piperidine-4-carboxylic acid
OR7826-01 100 mg

1- (5-Bromopyrimidin-2-yl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details
1- (5-Bromopyrimidin-2-yl) piperidine-4-carboxylic acid
OR7826-02 250 mg

1- (5-Bromopyrimidin-2-yl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details
1- (5-Bromopyrimidin-2-yl) piperidine-4-carboxylic acid
OR7826-03 1 g

1- (5-Bromopyrimidin-2-yl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details
1- (5-Bromopyrimidin-2-yl) piperidine-4-carboxylic acid
OR7826-04 5 g

1- (5-Bromopyrimidin-2-yl) piperidine-4-carboxylic acid

Sign In for Pricing
View Details