Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin Protein

This Mouse Transthyretin Protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Prealbumin)

UniProt

P07309

Expression Region

21-147aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 17.06-26.23 ng/mL.

Form

Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACRBP (NM_032489) Human Over-expression Lysate
LC403164 20 µg

ACRBP (NM_032489) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmoc-Arg (Pmc) Wang Resin
H0370751303.25G 25 g

Fmoc-Arg (Pmc) Wang Resin

Sign In for Pricing
View Details
Ki67 (MKI67) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI18G5]
TA803157AM 100 µL

Ki67 (MKI67) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI18G5]

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), 0.2mg/mL
BNUB2313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), 0.2mg/mL

Sign In for Pricing
View Details
FOXO4 Mouse Monoclonal Antibody [Clone ID: OTI2C5]
CF808589 100 µg

FOXO4 Mouse Monoclonal Antibody [Clone ID: OTI2C5]

Sign In for Pricing
View Details
uLK2 (NM_001142610) Human Over-expression Lysate
LC428207 20 µg

uLK2 (NM_001142610) Human Over-expression Lysate

Sign In for Pricing
View Details