Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Rbp4 Protein

This Mouse Rbp4 Protein spans the amino acid sequence from region 19-201aa. Purity: Greater than 94% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Plasma retinol-binding protein) (PRBP) (RBP)

UniProt

Q00724

Expression Region

19-201aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 94% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 38.07-75.83 ng/mL.

Form

Lyophilized powder

Molecular Weight

50.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNE2 Polyclonal Antibody
JOT-AP10633-01 20 µL

KCNE2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNE2 Polyclonal Antibody
JOT-AP10633-02 50 μL

KCNE2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNE2 Polyclonal Antibody
JOT-AP10633-03 100 µL

KCNE2 Polyclonal Antibody

Sign In for Pricing
View Details
3BP5L rabbit pAb
MBS8598360-01 0.1 mL

3BP5L rabbit pAb

Sign In for Pricing
View Details
3BP5L rabbit pAb
MBS8598360-02 0.1 mL (AF405L)

3BP5L rabbit pAb

Sign In for Pricing
View Details
3BP5L rabbit pAb
MBS8598360-03 0.1 mL (AF405S)

3BP5L rabbit pAb

Sign In for Pricing
View Details