Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPT2 Protein

This ANGPT2 Protein spans the amino acid sequence from region 19-495aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ANG-2)

UniProt

A0A8J8

Expression Region

19-495aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Dog ANGPT2 at 2 μg/mL can bind anti-ANGPT2 recombinant antibody, the EC50 is 2.836-4.992 ng/mL.

Form

Lyophilized powder

Molecular Weight

57.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX21 (NM_004728) Human Recombinant Protein
TP300917L 1 mg

DDX21 (NM_004728) Human Recombinant Protein

Sign In for Pricing
View Details
OR7E156P Adenovirus (Human)
35585051 1.0 mL

OR7E156P Adenovirus (Human)

Sign In for Pricing
View Details
Nalidixic acid
M14341-01 1 g

Nalidixic acid

Sign In for Pricing
View Details
Nalidixic acid
M14341-02 200 mg

Nalidixic acid

Sign In for Pricing
View Details
Nalidixic acid
M14341-03 1 mL x 10 mM in DMSO

Nalidixic acid

Sign In for Pricing
View Details
Nalidixic acid
M14341-04 500 mg

Nalidixic acid

Sign In for Pricing
View Details