Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vaccinia virus Envelope protein H3 Protein

This Vaccinia virus Envelope protein H3 Protein spans the amino acid sequence from region 1-56aa (X27S, X28S, X29S) . Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Ag35) (Virion envelope protein p35) (Fragments)

UniProt

P30895

Expression Region

1-56aa (X27S, X28S, X29S)

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Vaccinia virus (strain L-IVP) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEKRNVVVVKDDPDHYKDYAHDKKIDSSSRFIITGNKVKTEKINRQILDNAAKYVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta B (INHBB) (NM_002193) Human Tagged ORF Clone Lentiviral Particle
RC206253L4V 200 µL

Inhibin beta B (INHBB) (NM_002193) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr1504 (NM_146634) Mouse Tagged ORF Clone
MR213433 10 µg

Olfr1504 (NM_146634) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Nat8l Pre-designed siRNA Set A
SI109098A 1 Each

Mouse Nat8l Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Endothelin 1-21 (ET 1-21) ELISA Kit
EIA07479Rb 1 Kit

Rabbit Endothelin 1-21 (ET 1-21) ELISA Kit

Sign In for Pricing
View Details
RoboRocker 210
RR210-PL.US 1 Each

RoboRocker 210

Sign In for Pricing
View Details
CEACAM14 Adenovirus (Mouse)
15805054 1.0 mL

CEACAM14 Adenovirus (Mouse)

Sign In for Pricing
View Details