Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plasmodium falciparum Circumsporozoite Protein

This Plasmodium falciparum Circumsporozoite Protein spans the amino acid sequence from region 336-412aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CS) (PfCSP)

UniProt

P02893

Expression Region

336-412aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Plasmodium falciparum

Field of Research

Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKIKNSISTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYENDIEKKICKMEKCSSVFNVVNSSIGLIMVLSFLFLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal LAG-3 Antibody (2561B) [PE]
FAB10395P 0.1 mL

Rabbit Monoclonal LAG-3 Antibody (2561B) [PE]

Sign In for Pricing
View Details
Vicadrostat
E6401-100mg 100 mg

Vicadrostat

Sign In for Pricing
View Details
Rat Monoclonal HSF1 Antibody (4B4) [HRP]
NBP2-42206H 0.1 mL

Rat Monoclonal HSF1 Antibody (4B4) [HRP]

Sign In for Pricing
View Details
Human EFNA1 (Ephrin-A1) Quick ELISA Kit
orb2568247-01 48 Tests

Human EFNA1 (Ephrin-A1) Quick ELISA Kit

Sign In for Pricing
View Details
Human EFNA1 (Ephrin-A1) Quick ELISA Kit
orb2568247-02 96 Tests

Human EFNA1 (Ephrin-A1) Quick ELISA Kit

Sign In for Pricing
View Details
PACRG (NM_001080378) Human Over-expression Lysate
LH04784V 100 µg

PACRG (NM_001080378) Human Over-expression Lysate

Sign In for Pricing
View Details