Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EPS15 Protein

This Human EPS15 Protein spans the amino acid sequence from region 657-798aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein Eps15) (Protein AF-1p)

UniProt

P42566

Expression Region

657-798aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SALa (Salusin Alpha) ELISA Kit
EM23865 96 Tests

Mouse SALa (Salusin Alpha) ELISA Kit

Sign In for Pricing
View Details
P53 DINP1 Rabbit pAb, BF700 conjugated
orb2840990 100 µL

P53 DINP1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
VIM antibody - C-terminal region (ARP48226_P050)
ARP48226_P050 100 µL

VIM antibody - C-terminal region (ARP48226_P050)

Sign In for Pricing
View Details
SERPINB11 Antibody
46-897 0.1 mg

SERPINB11 Antibody

Sign In for Pricing
View Details
AChE antibody
orb74015 100 µL

AChE antibody

Sign In for Pricing
View Details
Herpes Simplex Virus I, Glycoprotein D (HSV I) (MaxLight 650)
H2033-20F-ML650 100 µL

Herpes Simplex Virus I, Glycoprotein D (HSV I) (MaxLight 650)

Sign In for Pricing
View Details