Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EPS15 Protein

This Human EPS15 Protein spans the amino acid sequence from region 657-798aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein Eps15) (Protein AF-1p)

UniProt

P42566

Expression Region

657-798aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (MaxLight 405)
MBS6191506-01 0.1 mL

NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (MaxLight 405)

Sign In for Pricing
View Details
NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (MaxLight 405)
MBS6191506-02 5x 0.1 mL

NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR) (MaxLight 405)

Sign In for Pricing
View Details
2- (Ethylsulfonyl) -4- (trifluoromethyl) pyrimidine
PC1002794-01 100 mg

2- (Ethylsulfonyl) -4- (trifluoromethyl) pyrimidine

Sign In for Pricing
View Details
2- (Ethylsulfonyl) -4- (trifluoromethyl) pyrimidine
PC1002794-02 250 mg

2- (Ethylsulfonyl) -4- (trifluoromethyl) pyrimidine

Sign In for Pricing
View Details
2- (Ethylsulfonyl) -4- (trifluoromethyl) pyrimidine
PC1002794-03 1 g

2- (Ethylsulfonyl) -4- (trifluoromethyl) pyrimidine

Sign In for Pricing
View Details
Breviscapin
MBS3607842-01 50 mg

Breviscapin

Sign In for Pricing
View Details