Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCGR3B Protein

This Human FCGR3B Protein spans the amino acid sequence from region 18-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Fc-gamma RIII-beta) (CD16-I) (Fc-gamma RIII) (Fc-gamma RIIIb) (FcRIII) (FcRIIIb) (FcR-10) (IgG Fc receptor III-1) (CD antigen CD16b)

UniProt

O75015

Expression Region

18-125aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mybbp1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4425005 3x 1.0 µg

Mybbp1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human EDAR shRNA Plasmid
abx957441-01 150 µg

Human EDAR shRNA Plasmid

Sign In for Pricing
View Details
Human EDAR shRNA Plasmid
abx957441-02 300 µg

Human EDAR shRNA Plasmid

Sign In for Pricing
View Details
Ccdc77 Mouse Gene Knockout Kit (CRISPR)
KN502745 1 Kit

Ccdc77 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Brassica rapa subsp. pekinensis Glutathione reductase, cytosolic (GR1), partial
MBS1219209 Inquire

Recombinant Brassica rapa subsp. pekinensis Glutathione reductase, cytosolic (GR1), partial

Sign In for Pricing
View Details
Anti-Rex1/ZFP42 Antibody Picoband®, PE Conjugate
A08177-1-PE 100 µg/Vial

Anti-Rex1/ZFP42 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details