Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FFAR3 Protein

This Human FFAR3 Protein spans the amino acid sequence from region 280-346aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(G-protein coupled receptor 41)

UniProt

O14843

Expression Region

280-346aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO34 (F-Box Protein 34, CGI-301, DKFZp547C162, FLJ20725, Fbx34, MGC126434, MGC126435)
246018 50 µL

FBXO34 (F-Box Protein 34, CGI-301, DKFZp547C162, FLJ20725, Fbx34, MGC126434, MGC126435)

Sign In for Pricing
View Details
Phospho-IRAK4 (Thr345) Rabbit Polyclonal Antibody (HRP)
orb503220 100 µL

Phospho-IRAK4 (Thr345) Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Glycogenin-1 (GYG1) Mouse ELISA Kit
D7717 96 Tests

Glycogenin-1 (GYG1) Mouse ELISA Kit

Sign In for Pricing
View Details
SMAD2 Antibody
CSB-PA080253-01 50 µg

SMAD2 Antibody

Sign In for Pricing
View Details
SMAD2 Antibody
CSB-PA080253-02 100 µg

SMAD2 Antibody

Sign In for Pricing
View Details
EXTL3 Polyclonal Antibody, PE-Cy5 Conjugated
bs-13123R-PE-Cy5 100 µL

EXTL3 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details