Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ITGB7 Protein

This Human ITGB7 Protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to gut-associated lymphoid tissue (GALT) .

UniProt

P26010

Expression Region

1-140aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB4 Antibody, HRP conjugated
CSB-PA001050LB01HU-01 50 µg

ABCB4 Antibody, HRP conjugated

Sign In for Pricing
View Details
ABCB4 Antibody, HRP conjugated
CSB-PA001050LB01HU-02 100 µg

ABCB4 Antibody, HRP conjugated

Sign In for Pricing
View Details
C11orf20, CT (C11orf20, Uncharacterized protein C11orf20) (PE)
MBS6279450-01 0.2 mL

C11orf20, CT (C11orf20, Uncharacterized protein C11orf20) (PE)

Sign In for Pricing
View Details
C11orf20, CT (C11orf20, Uncharacterized protein C11orf20) (PE)
MBS6279450-02 5x 0.2 mL

C11orf20, CT (C11orf20, Uncharacterized protein C11orf20) (PE)

Sign In for Pricing
View Details
Rabbit Anti-Rat IgG H&L (Cy3), 1 pack = 100 µLx5
BAL6196 1 Each

Rabbit Anti-Rat IgG H&L (Cy3), 1 pack = 100 µLx5

Sign In for Pricing
View Details
Human AP-5 complex subunit mu-1 (AP5M1) ELISA Kit
abx502073 96 Tests

Human AP-5 complex subunit mu-1 (AP5M1) ELISA Kit

Sign In for Pricing
View Details