Human MS4A1 Protein
This Human MS4A1 Protein spans the amino acid sequence from region 209-297aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(B-lymphocyte surface antigen B1) (Bp35) (Leukocyte surface antigen Leu-16) (Membrane-spanning 4-domains subfamily A member 1) (CD20)
UniProt
P11836
Expression Region
209-297aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
36.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
302405-ML750 100 µL
ECHDC3 (Enoyl-CoA Hydratase Domain-Containing Protein 3, Mitochondrial, ECHDC3) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
MBS1363396-01 0.02 mg (E-Coli)
Recombinant Danio rerio Proline-rich protein 15-like protein B (prr15lb)
Sign In for Pricing
View Details MBS1363396-02 0.1 mg (E-Coli)
Recombinant Danio rerio Proline-rich protein 15-like protein B (prr15lb)
Sign In for Pricing
View Details MBS1363396-03 0.02 mg (Yeast)
Recombinant Danio rerio Proline-rich protein 15-like protein B (prr15lb)
Sign In for Pricing
View Details MBS1363396-04 0.1 mg (Yeast)
Recombinant Danio rerio Proline-rich protein 15-like protein B (prr15lb)
Sign In for Pricing
View Details