Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human QSOX1 Protein

This Human QSOX1 Protein spans the amino acid sequence from region 101-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(hQSOX) (Quiescin Q6)

UniProt

O00391

Expression Region

101-175aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNA11 (NM_002067) Human Over-expression Lysate
LC419559 20 µg

GNA11 (NM_002067) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
E-EL-H1557-01 24 Tests

Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
E-EL-H1557-02 48 Tests

Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
E-EL-H1557-03 96 Tests

Human ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit

Sign In for Pricing
View Details
VGLL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A9]
TA810645BM 100 µL

VGLL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A9]

Sign In for Pricing
View Details
HSPA2 Antibody
OC-1925-01 50 μL

HSPA2 Antibody

Sign In for Pricing
View Details