Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFRP2 Protein

This Human SFRP2 Protein spans the amino acid sequence from region 68-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FRP-2) (sFRP-2) (Secreted apoptosis-related protein 1) (SARP-1)

UniProt

Q96HF1

Expression Region

68-186aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL7 Antibody Pair Set
E-KAB-0219 50 µL & 100 µg

Human CXCL7 Antibody Pair Set

Sign In for Pricing
View Details
Tide Quencher™ 7WS succinimidyl ester [TQ7WS SE]
2111-AAT 1 mg

Tide Quencher™ 7WS succinimidyl ester [TQ7WS SE]

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), Biotin conjugate, 0.1mg/mL
BNCB1832-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), 0.2mg/mL
BNUB1619-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), 0.2mg/mL

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (LMO2/1971), Biotin conjugate, 0.1mg/mL
BNCB1971-500 1x 500 µL

LMO2 (B-Cell Marker) (LMO2/1971), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NEURL (NEURL1) Rabbit Polyclonal Antibody
AP18132PU-N 400 µL

NEURL (NEURL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details