Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rh2b Protein

This Rh2b Protein spans the amino acid sequence from region 1800-2000aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PfR2Hb) (PfRH2b)

UniProt

C0H5F4

Expression Region

1875-2075aa

Tag

Tag-Free

Source

E.coli

Origin

Plasmodium falciparum (isolate 3D7)

Field of Research

Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKKQYIKTIEDVKFLLDSLNTIEEKNKSVANLEICTNKEDIKNLLKHVIKLANFSGIIVMSDTNTEITPENPLEDNDLLNLQLYFERKHEITSTLENDSDLELDHLGSNSDESIDNLKVYNDIIELHTYSTQILKYLDNIQKLKGDCNDLVKDCKELRELSTALYDLKIQITSVINRENDISNNIDIVSNKLNEIDAIQYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defender of Apoptotic Cell Death 1 (DAD1) (APC)
MBS6472164-01 0.1 mL

Defender of Apoptotic Cell Death 1 (DAD1) (APC)

Sign In for Pricing
View Details
Defender of Apoptotic Cell Death 1 (DAD1) (APC)
MBS6472164-02 5x 0.1 mL

Defender of Apoptotic Cell Death 1 (DAD1) (APC)

Sign In for Pricing
View Details
Human Mannose Associated Serine Protease 1 ELISA Kit
IHUMASP1KT 1 Each

Human Mannose Associated Serine Protease 1 ELISA Kit

Sign In for Pricing
View Details
PAOX (Polyamine Oxidase, PAO) (MaxLight 405)
MBS6430527-01 0.1 mL

PAOX (Polyamine Oxidase, PAO) (MaxLight 405)

Sign In for Pricing
View Details
PAOX (Polyamine Oxidase, PAO) (MaxLight 405)
MBS6430527-02 5x 0.1 mL

PAOX (Polyamine Oxidase, PAO) (MaxLight 405)

Sign In for Pricing
View Details
GAGE12F, NT (GAGE12F, G antigen 12F, GAGE12G, GAGE12I) (APC)
MBS6300984-01 0.2 mL

GAGE12F, NT (GAGE12F, G antigen 12F, GAGE12G, GAGE12I) (APC)

Sign In for Pricing
View Details