Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCD4 Protein

This CCD4 Protein spans the amino acid sequence from region 115-587aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(AtCCD4) (AtNCED4)

UniProt

O49675

Expression Region

115-587aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FAPVLDELPPTDCEIIHGTLPLSLNGAYIRNGPNPQFLPRGPYHLFDGDGMLHAIKIHNGKATLCSRYVKTYKYNVEKQTGAPVMPNVFSGFNGVTASVARGALTAARVLTGQYNPVNGIGLANTSLAFFSNRLFALGESDLPYAVRLTESGDIETIGRYDFDGKLAMSMTAHPKTDPITGETFAFRYGPVPPFLTYFRFDSAGKKQRDVPIFSMTSPSFLHDFAITKRHAIFAEIQLGMRMNMLDLVLEGGSPVGTDNGKTPRLGVIPKYAGDESEMKWFEVPGFNIIHAINAWDEDDGNSVVLIAPNIMSIEHTLERMDLVHALVEKVKIDLVTGIVRRHPISARNLDFAVINPAFLGRCSRYVYAAIGDPMPKISGVVKLDVSKGDRDDCTVARRMYGSGCYGGEPFFVARDPGNPEAEEDDGYVVTYVHDEVTGESKFLVMDAKSPELEIVAAVRLPRRVPYGFHGLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Mouse Janus Kinase 2 (JAK2) ELISA
KLM3771 1x 96 Well

GENLISA Mouse Janus Kinase 2 (JAK2) ELISA

Sign In for Pricing
View Details
Chymotrypsin, Human Pancreas (Not for Export EU)
C5070-07 1 mL

Chymotrypsin, Human Pancreas (Not for Export EU)

Sign In for Pricing
View Details
ECGF1 Antibody Blocking peptide
orb1446744 500 µg

ECGF1 Antibody Blocking peptide

Sign In for Pricing
View Details
YqgB Antibody
orb835854 2 mg

YqgB Antibody

Sign In for Pricing
View Details
Recombinant Rhodobacter capsulatus Energy-coupling factor transporter transmembrane protein BioN (bioN)
orb2918295-01 20 µg

Recombinant Rhodobacter capsulatus Energy-coupling factor transporter transmembrane protein BioN (bioN)

Sign In for Pricing
View Details
Recombinant Rhodobacter capsulatus Energy-coupling factor transporter transmembrane protein BioN (bioN)
orb2918295-02 100 µg

Recombinant Rhodobacter capsulatus Energy-coupling factor transporter transmembrane protein BioN (bioN)

Sign In for Pricing
View Details