Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAB35 Protein

This Human RAB35 Protein spans the amino acid sequence from region 1-201aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GTP-binding protein RAY) (Ras-related protein Rab-1C)

UniProt

Q15286

Expression Region

1-201aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human R-Spondin 2 (RSPO2) ELISA Kit
orb781300-01 48 Tests

Human R-Spondin 2 (RSPO2) ELISA Kit

Sign In for Pricing
View Details
Human R-Spondin 2 (RSPO2) ELISA Kit
orb781300-02 96 Tests

Human R-Spondin 2 (RSPO2) ELISA Kit

Sign In for Pricing
View Details
Human PTGS1 (Prostaglandin Endoperoxide Synthase 1) ValidElisa Kit
EK340988 96 Well

Human PTGS1 (Prostaglandin Endoperoxide Synthase 1) ValidElisa Kit

Sign In for Pricing
View Details
ALDH8A1, CT (Aldehyde Dehydrogenase Family 8 Member A1, Aldehyde Dehydrogenase 12, ALDH12) (AP) discontinued
A1334-38-AP 200 µL

ALDH8A1, CT (Aldehyde Dehydrogenase Family 8 Member A1, Aldehyde Dehydrogenase 12, ALDH12) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Human API5 Protein, N-His
HV437012-01 50 µg

Recombinant Human API5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human API5 Protein, N-His
HV437012-02 100 µg

Recombinant Human API5 Protein, N-His

Sign In for Pricing
View Details