Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL17A Protein

This Human IL17A Protein spans the amino acid sequence from region 26-132aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)

UniProt

Q16552

Expression Region

26-132aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystathionine-β-synthase (CBS) Activity Colorimetric Assay Kit
E-BC-K811-M-01 48 T (46 samples)

Cystathionine-β-synthase (CBS) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Cystathionine-β-synthase (CBS) Activity Colorimetric Assay Kit
E-BC-K811-M-02 96 T (94 samples)

Cystathionine-β-synthase (CBS) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
ZBTB3 (NM_024784) Human Recombinant Protein
TP306823 20 µg

ZBTB3 (NM_024784) Human Recombinant Protein

Sign In for Pricing
View Details
TNK1 (NM_003985) Human Recombinant Protein
TP761527 50 µg

TNK1 (NM_003985) Human Recombinant Protein

Sign In for Pricing
View Details
TentaGel® R RAM
R28023.5G 5 g

TentaGel® R RAM

Sign In for Pricing
View Details
Osteopontin (SPP1) (59-74) Rabbit Polyclonal Antibody
AP02136SU-S 20 µL

Osteopontin (SPP1) (59-74) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details