Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADAMTS18 Protein

This Human ADAMTS18 Protein spans the amino acid sequence from region 913-1040aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADAMTS21

UniProt

Q8TE60

Expression Region

913-1040aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB622620 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Snx27 Mouse Gene Knockout Kit (CRISPR)
KN516438 1 Kit

Snx27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL
BNC880282-100 1x 100 µL

HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant MHC Class I Monoclonal Antibody
AN301601L-01 50 µL

Recombinant MHC Class I Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant MHC Class I Monoclonal Antibody
AN301601L-02 100 µL

Recombinant MHC Class I Monoclonal Antibody

Sign In for Pricing
View Details
CUTA Rabbit Polyclonal Antibody
TA365704 100 µL

CUTA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details