Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADAMTS18 Protein

This Human ADAMTS18 Protein spans the amino acid sequence from region 913-1040aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADAMTS21

UniProt

Q8TE60

Expression Region

913-1040aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem141 (NM_001040130) Mouse Tagged ORF Clone
MG200120 10 µg

Tmem141 (NM_001040130) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LRRFIP1 (NM_001137551) Human Over-expression Lysate
LC427934 20 µg

LRRFIP1 (NM_001137551) Human Over-expression Lysate

Sign In for Pricing
View Details
(RS)-3,5-DHPG
TRC-D450028-10MG 10 mg

(RS)-3,5-DHPG

Sign In for Pricing
View Details
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Recombinant Protein
TP305289 20 µg

G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details