Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fam3b Protein

This Mouse Fam3b Protein spans the amino acid sequence from region 30-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine-like protein 2-21 Pancreatic-derived factor Short name, PANDER

UniProt

Q9D309

Expression Region

30-235aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMUBP2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11757R-BF594 100 µL

SMUBP2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Magea5 shRNA (UAS) - Lentiviral mouse Magea5 shRNA (UAS, RFP) (25)
GTR15126659 1 Vial

Lentiviral mouse Magea5 shRNA (UAS) - Lentiviral mouse Magea5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
LRGUK Recombinant Protein (Human)
RP069234 100 µg

LRGUK Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit DBC1/p30 DBC Antibody
orb1530208-01 10 µL

Rabbit DBC1/p30 DBC Antibody

Sign In for Pricing
View Details
Rabbit DBC1/p30 DBC Antibody
orb1530208-02 100 µL

Rabbit DBC1/p30 DBC Antibody

Sign In for Pricing
View Details
PAX6 Rabbit Polyclonal Antibody
orb158103 100 µg

PAX6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details