Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SMURF1 Protein

This Human SMURF1 Protein spans the amino acid sequence from region 198-374aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(hSMURF1) (HECT-type E3 ubiquitin transferase SMURF1) (SMAD ubiquitination regulatory factor 1) (SMAD-specific E3 ubiquitin-protein ligase 1)

UniProt

Q9HCE7

Expression Region

198-374aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPR141 activation kit by CRISPRa
GA117734 1 Kit

Human GPR141 activation kit by CRISPRa

Sign In for Pricing
View Details
LAG3 Antibody
KC-47733-01 50 μL

LAG3 Antibody

Sign In for Pricing
View Details
LAG3 Antibody
KC-47733-02 100 µL

LAG3 Antibody

Sign In for Pricing
View Details
LAG3 Antibody
KC-47733-03 1 mL

LAG3 Antibody

Sign In for Pricing
View Details
COA5 (NM_001008215) Human Recombinant Protein
TP308299L 1 mg

COA5 (NM_001008215) Human Recombinant Protein

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), 1mg/mL
BNUM0752-50 1x 50 µL

Bcl-x (BX006 + 2H12), 1mg/mL

Sign In for Pricing
View Details