Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCSER2 Protein

This Human CCSER2 Protein spans the amino acid sequence from region 231-328aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Coiled-coil serine-rich protein 2) (Protein GCAP14 homolog)

UniProt

Q9H7U1

Expression Region

231-328aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFLPPSSITRSHSFNRAVDLTKPYQNQQLSIRVPLRSSMLTRNSRQPEVLNGNEHLGYGFNRPYAAGGKKLALPNGPGVTSTLGYRMVHPSLLKSSRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS37D Protein Vector (Rat) (pPM-C-HA)
PV316056 500 ng

VPS37D Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human INPP5J (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A) ELISA Kit
orb2816908-01 48 Tests

Human INPP5J (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A) ELISA Kit

Sign In for Pricing
View Details
Human INPP5J (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A) ELISA Kit
orb2816908-02 96 Tests

Human INPP5J (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A) ELISA Kit

Sign In for Pricing
View Details
Uridine 5'-monophosphate
296545-01 250 mg

Uridine 5'-monophosphate

Sign In for Pricing
View Details
Uridine 5'-monophosphate
296545-02 500 mg

Uridine 5'-monophosphate

Sign In for Pricing
View Details
Uridine 5'-monophosphate
296545-03 1 g

Uridine 5'-monophosphate

Sign In for Pricing
View Details