Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Sarcolipin Protein

This Human Sarcolipin Protein spans the amino acid sequence from region 1-31aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O00631

Expression Region

1-31aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGINTRELFLNFTIVLITVILMWLLVRSYQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synphilin-1 Rabbit Polyclonal Antibody (BF647)
orb2473386 100 µL

Synphilin-1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Bovine Interleukin 12A (IL12A) ELISA Kit
EKU05196 96 Tests

Bovine Interleukin 12A (IL12A) ELISA Kit

Sign In for Pricing
View Details
ORMDL3 Peptide
DF14231-BP 1 mg

ORMDL3 Peptide

Sign In for Pricing
View Details
Rabbit Anti Human TRPV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 120UL
IRBAMLTRPV1AP99120UL 120 µL

Rabbit Anti Human TRPV1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 120UL

Sign In for Pricing
View Details
Recombinant Human CENPE, N-His
MBS1574450-01 0.1 mg

Recombinant Human CENPE, N-His

Sign In for Pricing
View Details
Recombinant Human CENPE, N-His
MBS1574450-02 1 mg

Recombinant Human CENPE, N-His

Sign In for Pricing
View Details