Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Sarcolipin Protein

This Human Sarcolipin Protein spans the amino acid sequence from region 1-31aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O00631

Expression Region

1-31aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGINTRELFLNFTIVLITVILMWLLVRSYQY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sidt2 Rat shRNA Lentiviral Particle (Locus ID 315617)
TL706685V 500 µL Each

Sidt2 Rat shRNA Lentiviral Particle (Locus ID 315617)

Sign In for Pricing
View Details
Innovative Grade US Origin Bovine Bone Metatarsus Fresh in Saline
IGBOBMTSS 1 Each

Innovative Grade US Origin Bovine Bone Metatarsus Fresh in Saline

Sign In for Pricing
View Details
Recombinant Human EREG Protein, N-His
AP90095 50 µg

Recombinant Human EREG Protein, N-His

Sign In for Pricing
View Details
TSPYP4 sgRNA CRISPR Lentivector (Human) (Target 1)
K2544602 1.0 µg DNA

TSPYP4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Gab1, phosphorylated (Tyr659) (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) (MaxLight 750) discontinued
G1012-10C-ML750 100 µL

Gab1, phosphorylated (Tyr659) (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PLGF1 protein
MBS5304510-01 0.025 mg

PLGF1 protein

Sign In for Pricing
View Details