Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Trap1a Protein

This Mouse Trap1a Protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P19473

Expression Region

1-134aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDNKKPDKAHSGSGGDGDGNRCNLLHRYSLEEILPYLGWLVFAVVTTSFLALQMFIDALYEEQYERDVAWIARQSKRMSSVDEDEDDEDDEDDYYDDEDDDDDAFYDDEDDEEEELENLMDDESEDEAEEEMS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT7 siRNA Oligos set (Human)
21083171 3x 5 nmol

FUT7 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human BANP (NM_001173543) AAV Particle
RC230218A1V 250 µL

Human BANP (NM_001173543) AAV Particle

Sign In for Pricing
View Details
Human Platelet Derived Growth Factor C (PDGFC) ELISA Kit
RDR-PDGFC-Hu-48Tests 48 Tests

Human Platelet Derived Growth Factor C (PDGFC) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal MARCH1 Antibody (3D2)
H00055016-M02 0.1 mg

Mouse Monoclonal MARCH1 Antibody (3D2)

Sign In for Pricing
View Details
TRAPPC3 protein (His tag)
80R-2194 0.1 mg

TRAPPC3 protein (His tag)

Sign In for Pricing
View Details
Noradrenaline (Norepinephrine) Impurity 117
RM-N153017-01 10 mg

Noradrenaline (Norepinephrine) Impurity 117

Sign In for Pricing
View Details