Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fcn1 Protein

This Mouse Fcn1 Protein spans the amino acid sequence from region 18-334aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Collagen/fibrinogen domain-containing protein 1) (Ficolin-A) (Ficolin-alpha) (M-ficolin)

UniProt

O70165

Expression Region

18-334aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQALGQERGACPDVKVVGLGAQDKVVVIQSCPGFPGPPGPKGEPGSPAGRGERGFQGSPGKMGPAGSKGEPGTMGPPGVKGEKGDTGAAPSLGEKELGDTLCQRGPRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSIDFFRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKYKLTLGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRYLSGSHESYADGINWGTGQGHHYSYKVAEMKIRAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl6b Mouse Gene Knockout Kit (CRISPR)
KN502111 1 Kit

Bcl6b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FUT2 (NM_001097638) Human Over-expression Lysate
LY420412 100 µg

FUT2 (NM_001097638) Human Over-expression Lysate

Sign In for Pricing
View Details
TRAF1 Polyclonal Antibody
E-AB-90008-01 60 µL

TRAF1 Polyclonal Antibody

Sign In for Pricing
View Details
TRAF1 Polyclonal Antibody
E-AB-90008-02 120 µL

TRAF1 Polyclonal Antibody

Sign In for Pricing
View Details
TRAF1 Polyclonal Antibody
E-AB-90008-03 200 µL

TRAF1 Polyclonal Antibody

Sign In for Pricing
View Details
DENND2B (NM_213618) Human Over-expression Lysate
LC403890 20 µg

DENND2B (NM_213618) Human Over-expression Lysate

Sign In for Pricing
View Details