Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL1 Protein (Biotin)

This Human CCL1 Protein (Biotin) spans the amino acid sequence from region 24-96aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309)

UniProt

P22362

Expression Region

24-96aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PAK1 Antibody
RC-4521-01 50 μL

Recombinant PAK1 Antibody

Sign In for Pricing
View Details
Recombinant PAK1 Antibody
RC-4521-02 100 µL

Recombinant PAK1 Antibody

Sign In for Pricing
View Details
Recombinant PAK1 Antibody
RC-4521-03 1 mL

Recombinant PAK1 Antibody

Sign In for Pricing
View Details
CD239 (BCAM) (NM_001013257) Human Over-expression Lysate
LY422959 100 µg

CD239 (BCAM) (NM_001013257) Human Over-expression Lysate

Sign In for Pricing
View Details
IGFL3 (NM_207393) Human Over-expression Lysate
LY404004 100 µg

IGFL3 (NM_207393) Human Over-expression Lysate

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3083), CF740 conjugate, 0.1mg/mL
BNC743083-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/3083), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details