Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse C1s1 Protein

This Mouse C1s1 Protein spans the amino acid sequence from region 16-688aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(C1 esterase) (Complement component 1 subcomponent s-A)

UniProt

Q8CG14

Expression Region

16-688aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

77.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYFTHVDIEPSESCAYDSVQIISGGIEEGRLCGQKTSKSPNSPIIEEFQFPYNKLQVVFTSDFSNEERFTGFAAYYTAIDINECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVNCSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNCPDSLTFASKNQQFGPYCGNGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISCAKKITANSTWEPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKCQPVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQLGIELPRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dynamin 1 ELISA Kit
MBS732448-01 48 Well

Rat Dynamin 1 ELISA Kit

Sign In for Pricing
View Details
Rat Dynamin 1 ELISA Kit
MBS732448-02 96 Well

Rat Dynamin 1 ELISA Kit

Sign In for Pricing
View Details
Rat Dynamin 1 ELISA Kit
MBS732448-03 5x 96 Well

Rat Dynamin 1 ELISA Kit

Sign In for Pricing
View Details
Rat Dynamin 1 ELISA Kit
MBS732448-04 10x 96 Well

Rat Dynamin 1 ELISA Kit

Sign In for Pricing
View Details
Human RGL3 Pre-designed siRNA Set B
SI013672B 1 Each

Human RGL3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Kat5 ORF Vector (Mouse) (pORF)
ORF048280 1.0 µg DNA

Kat5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details