Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CsgA Protein

This csgA Protein spans the amino acid sequence from region 45-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P28307

Expression Region

45-134aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNIYQYGGGNSALALQTDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGGGNGAAVDQTASNSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Foxj2 shRNA (UAS) - Lentiviral mouse Foxj2 shRNA (UAS, GFP) plasmid
GTR15126142 1 Vial

Lentiviral mouse Foxj2 shRNA (UAS) - Lentiviral mouse Foxj2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Guinea pig Pepsin ELISA Kit
MBS261040-01 48 Well

Guinea pig Pepsin ELISA Kit

Sign In for Pricing
View Details
Guinea pig Pepsin ELISA Kit
MBS261040-02 96 Well

Guinea pig Pepsin ELISA Kit

Sign In for Pricing
View Details
Guinea pig Pepsin ELISA Kit
MBS261040-03 5x 96 Well

Guinea pig Pepsin ELISA Kit

Sign In for Pricing
View Details
Guinea pig Pepsin ELISA Kit
MBS261040-04 10x 96 Well

Guinea pig Pepsin ELISA Kit

Sign In for Pricing
View Details
FDPSP6 Protein Vector (Human) (pPB-C-His)
PV078169 500 ng

FDPSP6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details