Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila melanogaster Protein shifted Protein

This Drosophila melanogaster Protein shifted Protein spans the amino acid sequence from region 31-456aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(WIF-1-like protein)

UniProt

Q9W3W5

Expression Region

31-456aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Developmental Biology, Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RQQHHNRNNNNNNRRADSSSSEEGHGNTSDGLDNFADQDASFVGHGHQPRRGQRKKQQGGGGGGSGGGGGNGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFYGRHCNGRKRRHVHRNDDSKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-500 1x 500 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF405S conjugate, 0.1mg/mL
BNC041960-100 1x 100 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF740 conjugate, 0.1mg/mL
BNC740693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF740 conjugate, 0.1mg/mL
BNC741888-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details