Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ccdA Protein

This E. coli ccdA Protein spans the amino acid sequence from region 1-72aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein LetA)

UniProt

Q46995

Expression Region

1-72aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKQRITVAGDSDNYQLLKAYDVNISGLVSTPMQNEARRLRPERWKVANQEGMAEVARFIEMNGSFADENRDW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Thrombomodulin [QBEND/40]
orb2645826 0.2 mg

Anti-Thrombomodulin [QBEND/40]

Sign In for Pricing
View Details
ACD Antibody
orb419592 100 µL

ACD Antibody

Sign In for Pricing
View Details
PCBD1 Rabbit Polyclonal Antibody (PE)
orb489816 100 µL

PCBD1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Anti-VE-Cadherin CDH5-Antibody Picoband®, Dylight550 Conjugate
PA2079-Dylight550 100 µg

Anti-VE-Cadherin CDH5-Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
IRAK4, CT (interleukin-1 receptor-associated kinase 4, Interleukin-1 receptor-associated kinase 4, IPD1, IRAK-4, NY-REN-64, NY-REN-64 antigen, REN64) (FITC) discontinued
I8600-17G-FITC 100 µL

IRAK4, CT (interleukin-1 receptor-associated kinase 4, Interleukin-1 receptor-associated kinase 4, IPD1, IRAK-4, NY-REN-64, NY-REN-64 antigen, REN64) (FITC) discontinued

Sign In for Pricing
View Details
Lentiviral human XPR1 shRNA (UAS) - Lentiviral human XPR1 shRNA (UAS, GFP) plasmid
GTR15080398 1 Vial

Lentiviral human XPR1 shRNA (UAS) - Lentiviral human XPR1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details