Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli Escherichia coli Ferric aerobactin receptor Protein

This E. coli Escherichia coli Ferric aerobactin receptor Protein spans the amino acid sequence from region 26-732aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cloacin receptor)

UniProt

P14542

Expression Region

26-732aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

85.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QQTDDETFVVSANRSNRTVAEMAQTTWVIENAELEQQIQGGKELKDALAQLIPGLDVSSRSRTNYGMNVRGRPLVVLVDGVRLNSSRTDSRQLDSIDPFNMHHIEVIFGATSLYGGGSTGGLINIVTKKGQPETMMEFEAGTKSGFSSSKDHDERIAGAVSGGNEHISGRLSVAYQKFGGWFDGNGDATLLDNTQTGLQYSDRLDIMGTGTLNIDESRQLQLITQYYKSQGDDDYGLNLGKGFSAIRGTSTPFVSNGLNSDRIPGTDGHLISLQYSDSAFLGQELVGQVYYRDESLRFYPFPTVNANKQVTAFSSSQQDTDQYGMKLTLNSKPMDGWQITWGLDADHERFTSNQMFFDLAQASASGGLNNKKIYTTGRYPSYDITNLAAFLQSGYDINNLFTLNGGVRYQYTENKIDDFIGYAQQRQIGAGKATSADAFWRLSRLRHFLFNAGLLMHITEPQQAWLNFSQGLELPDPGKYYGRGIYGAAVNGHLPLTKSVNVSDSKLEGVKVDSYELGWRFTGNNLRTQIAAYYSISDKSVVANKDLTISVVDDKRRIYGVEGAVDYLIPDTDWSTGVNFNVLKTESKVNGTWQKYDVKTASPSKATAYIGWAPDPWSLRVQSTTSFDVSDAQGYKVDGYTTVDLLGSYQLPVGTLSFSIENLFDRDYTTVWGQRAPLYYSPGYGPASLYDYKGRGRTFGLNYSVLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kaempferol-3-O-α-L-rhamnopyranosyl- (1→6) -β-D-glucopyranosyl- (1→2) -β-D-glucopyranoside
TN6460 10 mg

Kaempferol-3-O-α-L-rhamnopyranosyl- (1→6) -β-D-glucopyranosyl- (1→2) -β-D-glucopyranoside

Sign In for Pricing
View Details
WSCD1 CRISPRa sgRNA lentivector (set of three targets)(Human)
50471121 3x 1.0µg DNA

WSCD1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
[4- (Ethoxymethoxy) phenyl]methanol
CMA32077-01 50 mg

[4- (Ethoxymethoxy) phenyl]methanol

Sign In for Pricing
View Details
[4- (Ethoxymethoxy) phenyl]methanol
CMA32077-02 0.5 g

[4- (Ethoxymethoxy) phenyl]methanol

Sign In for Pricing
View Details
Fenprostalene
HY-126762 1 Each

Fenprostalene

Sign In for Pricing
View Details
Ammecr1 Mouse siRNA Oligo Duplex (Locus ID 56068)
SR411622 1 Kit

Ammecr1 Mouse siRNA Oligo Duplex (Locus ID 56068)

Sign In for Pricing
View Details