Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant PROLM25 Protein

This Plant PROLM25 Protein spans the amino acid sequence from region 20-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P17048

Expression Region

20-156aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Oryza sativa subsp. japonica (Rice)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RFDPLSQSYRQYQLQSHLLLQQQVLSPCSEFVRQQYSIVATPFWQPATFQLINNQVMQQQCCQQLRLVAQQSHYQAISIVQAIVQQLQLQQFSGVYFDQTQAQAQTLLTFNLPSICGIYPNYYSAPRSIATVGGVWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS704579 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD19 (CVID3/429), CF647 conjugate, 0.1mg/mL
BNC470429-100 1x 100 µL

CD19 (CVID3/429), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ptp4a1 (BC055039) Mouse Tagged ORF Clone
MG201481 10 µg

Ptp4a1 (BC055039) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MyFuge™ 5D Mini-Centrifuge
C2595-E 1 Each

MyFuge™ 5D Mini-Centrifuge

Sign In for Pricing
View Details
Disperse Yellow 1 (Technical Grade)
TRC-D495323-5G 5 g

Disperse Yellow 1 (Technical Grade)

Sign In for Pricing
View Details
Phospho-LC3B Antibody (pT93/Y99)
F48639-0.4ML 0.4 mL

Phospho-LC3B Antibody (pT93/Y99)

Sign In for Pricing
View Details