Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant PROLM25 Protein

This Plant PROLM25 Protein spans the amino acid sequence from region 20-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P17048

Expression Region

20-156aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Oryza sativa subsp. japonica (Rice)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RFDPLSQSYRQYQLQSHLLLQQQVLSPCSEFVRQQYSIVATPFWQPATFQLINNQVMQQQCCQQLRLVAQQSHYQAISIVQAIVQQLQLQQFSGVYFDQTQAQAQTLLTFNLPSICGIYPNYYSAPRSIATVGGVWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NKG2D Recombinant Rabbit monoclonal Antibody
HA725300 100 µL

Human NKG2D Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), CF740 conjugate, 0.1mg/mL
BNC740726-100 1x 100 µL

DOG-1 (DG1/447 + DOG1.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p95 NBS1 (NBN) Rabbit Polyclonal Antibody
AP06274PU-N 100 µg

p95 NBS1 (NBN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Spleen
CP610966 150 µg

Tissue Protein Lysate, Spleen

Sign In for Pricing
View Details
C-Myc (MYC909), CF568 conjugate, 0.1mg/mL
BNC680909-100 1x 100 µL

C-Myc (MYC909), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3352), CF568 conjugate, 0.1mg/mL
BNC683352-500 1x 500 µL

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3352), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details