Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRSS1 Protein

This Human PRSS1 Protein spans the amino acid sequence from region 104-206aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-trypsin (Cationic trypsinogen) (Serine protease 1) (Trypsin I) (TRP1) (TRY1) (TRYP1)

UniProt

P07477

Expression Region

104-206aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mLlt3 (NM_029931) Mouse Untagged Clone
MC211043 10 µg

mLlt3 (NM_029931) Mouse Untagged Clone

Sign In for Pricing
View Details
AURKC Rabbit Polyclonal Antibody
55377-01 50 µL

AURKC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AURKC Rabbit Polyclonal Antibody
55377-02 100 µL

AURKC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COQ2 HDR Plasmid (m)
sc-428117-HDR 20 µg

COQ2 HDR Plasmid (m)

Sign In for Pricing
View Details
Fyn (phospho-Y530) polyclonal antibody
E43S4076 100 µL

Fyn (phospho-Y530) polyclonal antibody

Sign In for Pricing
View Details
Sheep RGM Domain Family Member B (RGMB) ELISA Kit
MBS9902752-01 48 Well

Sheep RGM Domain Family Member B (RGMB) ELISA Kit

Sign In for Pricing
View Details