Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRSS1 Protein

This Human PRSS1 Protein spans the amino acid sequence from region 104-206aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-trypsin (Cationic trypsinogen) (Serine protease 1) (Trypsin I) (TRP1) (TRY1) (TRYP1)

UniProt

P07477

Expression Region

104-206aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SET And MYND Domain-Containing Protein 4 (SMYD4) Antibody
abx115492 100 µL

SET And MYND Domain-Containing Protein 4 (SMYD4) Antibody

Sign In for Pricing
View Details
UFL1 siRNA (Human)
MBS8223130-01 15 nmol

UFL1 siRNA (Human)

Sign In for Pricing
View Details
UFL1 siRNA (Human)
MBS8223130-02 30 nmol

UFL1 siRNA (Human)

Sign In for Pricing
View Details
UFL1 siRNA (Human)
MBS8223130-03 5x 30 nmol

UFL1 siRNA (Human)

Sign In for Pricing
View Details
HoxB3 (m) -PR
sc-38691-PR 10 µM - 20 µL

HoxB3 (m) -PR

Sign In for Pricing
View Details
RNY3 ORF Vector (Human) (pORF)
40616011 1.0 µg DNA

RNY3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details