Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPS4Y1 Protein

This Human RPS4Y1 Protein spans the amino acid sequence from region 1-263aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Small ribosomal subunit protein eS4)

UniProt

P22090

Expression Region

1-263aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Phenylpyridine-2-carboxylic Acid
TRC-P336600-25G 25 g

6-Phenylpyridine-2-carboxylic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS701116 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
Cytokeratin 8/18 (B22.1 + B23.1), CF543 conjugate, 0.1mg/mL
BNC431221-500 1x 500 µL

Cytokeratin 8/18 (B22.1 + B23.1), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UPK3A (Uroplakin 3A) (Rabbit PAb), CF568 conjugate, 0.1mg/mL
BNC680409-100 1x 100 µL

UPK3A (Uroplakin 3A) (Rabbit PAb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ST13 Monoclonal Antibody
AN301664L-01 50 µL

Recombinant ST13 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ST13 Monoclonal Antibody
AN301664L-02 100 µL

Recombinant ST13 Monoclonal Antibody

Sign In for Pricing
View Details