Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPS4Y1 Protein

This Human RPS4Y1 Protein spans the amino acid sequence from region 1-263aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Small ribosomal subunit protein eS4)

UniProt

P22090

Expression Region

1-263aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R)-2,3-Dihydro-N-2-propen-1-yl-1H-inden-1-amine Ethanedioate
TRC-D450435-250MG 250 mg

(1R)-2,3-Dihydro-N-2-propen-1-yl-1H-inden-1-amine Ethanedioate

Sign In for Pricing
View Details
Citric Acid
TRC-C521000-50G 50 g

Citric Acid

Sign In for Pricing
View Details
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), 0.2mg/mL
BNUB2256-100 1x 100 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), 0.2mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Serum,
AA-2123-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Serum,

Sign In for Pricing
View Details
Fumonisin B2 (>90%)
TRC-F973870-2.5MG 2.5 mg

Fumonisin B2 (>90%)

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details