Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KDM6A Protein

This Human KDM6A Protein spans the amino acid sequence from region 1095-1258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Histone demethylase UTX) (Ubiquitously-transcribed TPR protein on the X chromosome) (Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein) ([histone H3]-trimethyl-L-lysine (27) demethylase 6A)

UniProt

O15550

Expression Region

1095-1258aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acads Mouse Gene Knockout Kit (CRISPR)
KN500693 1 Kit

Acads Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Trestolone
TRC-T719600-1G 1 g

Trestolone

Sign In for Pricing
View Details
SAMD13 (NM_001010971) Human Recombinant Protein
TP320928 20 µg

SAMD13 (NM_001010971) Human Recombinant Protein

Sign In for Pricing
View Details
Sigma1 receptor (SIGMAR1) Human Gene Knockout Kit (CRISPR)
KN201206BN 1 Kit

Sigma1 receptor (SIGMAR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CBX2 (N-term) Rabbit Polyclonal Antibody
AP50745PU-N 400 µL

CBX2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), 0.2mg/mL
BNUB2368-100 1x 100 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), 0.2mg/mL

Sign In for Pricing
View Details