Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alp2 Protein

This alp2 Protein spans the amino acid sequence from region 137-495aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ALP2) (Autophagic serine protease alp2) (allergen Asp f 18)

UniProt

P87184

Expression Region

137-495aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDPTVEKSAPWGLARISHRDSLSFGTFNKYLYASEGGEGVDAYTIDTGINVDHVDFEGRAQWGKTIPTDDEDADGNGHGTHCSGTIAGRKYGVAKKANLYAVKVLRSSGSGTMSDVVAGVEWAVKSHLKKVKDAKDGKIKGFKGSVANMSLGGGKSRTLEAAVNAGVEAGLHFAVAAGNDNADACNYSPAAAENPITVGASTLQDERAYFSNYGKCTDIFAPGLNILSTWIGSKHAVNTISGTSMASPHIAGLLAYFVSLQPSKDSAFAVDELTPKKLKKDIIAIATQGALTDIPSDTPNLLAWNGGGSSNYTDIIASGGYKVNASVKDRFEGLVHKAEKLLTEELGAIYSEIHDAAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PREX1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV624162 1.0 µg DNA

PREX1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
ARL5 (ADP-ribosylation factor-like protein 5A, ARL5A, ARFLP5) (AP) discontinued
123533-AP 100 µL

ARL5 (ADP-ribosylation factor-like protein 5A, ARL5A, ARFLP5) (AP) discontinued

Sign In for Pricing
View Details
LECT1 (Leukocyte Cell Derived Chemotaxin 1, CHM1, CHM-I, BRICD3, MYETS1) discontinued
219053-01 20 µL

LECT1 (Leukocyte Cell Derived Chemotaxin 1, CHM1, CHM-I, BRICD3, MYETS1) discontinued

Sign In for Pricing
View Details
LECT1 (Leukocyte Cell Derived Chemotaxin 1, CHM1, CHM-I, BRICD3, MYETS1) discontinued
219053-02 100 µL

LECT1 (Leukocyte Cell Derived Chemotaxin 1, CHM1, CHM-I, BRICD3, MYETS1) discontinued

Sign In for Pricing
View Details
POLL Antibody
MBS8604979-01 0.1 mg

POLL Antibody

Sign In for Pricing
View Details
POLL Antibody
MBS8604979-02 0.1 mL (AF405L)

POLL Antibody

Sign In for Pricing
View Details