Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IGF2 Protein

This Bovine IGF2 Protein spans the amino acid sequence from region 25-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IGF-II) (Erythrotropin)

UniProt

P07456

Expression Region

25-91aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cis-4-Br-2,5-F2-PCPA
MBS5803087 Inquire

cis-4-Br-2,5-F2-PCPA

Sign In for Pricing
View Details
50uL Hamilton Co-Re Style Liquid Level Sens Tip
PIP1664 10 / PCK

50uL Hamilton Co-Re Style Liquid Level Sens Tip

Sign In for Pricing
View Details
H3F3A antibody
OAGA01123-100UL 100 µL

H3F3A antibody

Sign In for Pricing
View Details
SPATA19 3'UTR Lenti-reporter-Luc Vector
45218081 1.0 µg

SPATA19 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans lagr-1 Polyclonal Antibody
MBS9000818 Inquire

Rabbit anti-Caenorhabditis elegans lagr-1 Polyclonal Antibody

Sign In for Pricing
View Details
Opn4 (NM_013887) Mouse Tagged ORF Clone
MR225286 10 µg

Opn4 (NM_013887) Mouse Tagged ORF Clone

Sign In for Pricing
View Details