Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IGF2 Protein

This Bovine IGF2 Protein spans the amino acid sequence from region 25-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IGF-II) (Erythrotropin)

UniProt

P07456

Expression Region

25-91aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ro 48-8071 fumarate
256485-01 10 mg

Ro 48-8071 fumarate

Sign In for Pricing
View Details
Ro 48-8071 fumarate
256485-02 50 mg

Ro 48-8071 fumarate

Sign In for Pricing
View Details
PDZK1 Rabbit Polyclonal Antibody
orb513309 100 µg

PDZK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Neisseria gonorrhoeae Quantified Bacterial DNA Standard
28296 1 Unit

Neisseria gonorrhoeae Quantified Bacterial DNA Standard

Sign In for Pricing
View Details
Rasgrp2 Mouse shRNA Plasmid (Locus ID 19395)
TR509458 1 Kit

Rasgrp2 Mouse shRNA Plasmid (Locus ID 19395)

Sign In for Pricing
View Details
THP-SS-PEG1-Tos
BIPG1855-01 100 mg

THP-SS-PEG1-Tos

Sign In for Pricing
View Details