Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Scp2 Protein

This Rat Scp2 Protein spans the amino acid sequence from region 1-547aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(SCP-2) (Acetyl-CoA C-myristoyltransferase) (Non-specific lipid-transfer protein) (NSL-TP) (Propanoyl-CoA C-acyltransferase) (SCP-2/3-oxoacyl-CoA thiolase) (SCP-2/thiolase) (SCP-chi) (Sterol carrier protein X) (SCP-X)

UniProt

P11915

Expression Region

1-547aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSVALNSPRLPRVFVVGVGMTKFMKPGGENSRDYPDLAKEAGQKALADRQIPYSAVEQACVGYVYGESTCGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAQQLVQGGLANCVLALGFEKMEKGSLGTKYSDRSNPLEKHIDVLINKYGMSACPFAPQLFGSAGKEHMETYGTKVEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEIMKSRPVFDFLTVLQCCPTSDGAAAAIVSSEEFVQKHGLQSKAVEIVAQEMVTDMPSTFEEKSVIKMVGYDMSKEAARKCYEKSGLGPSDVDVIELHDCFSTNELLTYEALGLCPEGQGGALVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAAVVTLYRMGFPEAASSFRTHQISAAPTSSAGDGFKANLIFKEIEKKLEEEGEEFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPDSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQSLQLQPDKAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP3 (N-term) Rabbit Polyclonal Antibody
AP11664PU-N 400 µL

BMP3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYT11 (NM_152280) Human Recombinant Protein
TP762135 50 µg

SYT11 (NM_152280) Human Recombinant Protein

Sign In for Pricing
View Details
RNF149 Human Gene Knockout Kit (CRISPR)
KN207979RB 1 Kit

RNF149 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F1104A-01 25 µg

Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
Purified Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F1104A-02 100 µg

Purified Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
Peroxiredoxin 5 (PRDX5) Human Gene Knockout Kit (CRISPR)
KN210709BN 1 Kit

Peroxiredoxin 5 (PRDX5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details