Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Medicago truncatula Carbohydrate-binding module family Protein

This Medicago truncatula Carbohydrate-binding module family Protein spans the amino acid sequence from region 29-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Putative LysM domain-containing protein)

UniProt

G7JRT4

Expression Region

29-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Medicago truncatula (Barrel medic) (Medicago tribuloides)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPICSTIHGVQVGETCFSIIQKFAIEQPLFLRLNPNINCSGIFVGQWVCVNGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TNFRSF4 shRNA (UAS) - Lentiviral human TNFRSF4 shRNA (UAS, GFP) (25)
GTR15105524 1 Vial

Lentiviral human TNFRSF4 shRNA (UAS) - Lentiviral human TNFRSF4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
OOMC00023-25MG - Dabrafenib (GSK2118436)
OOMC00023-25MG 25 mg

OOMC00023-25MG - Dabrafenib (GSK2118436)

Sign In for Pricing
View Details
APOH Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2504415 100 µL

APOH Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Mouse ERK1/2 (Extracellular Signal Regulated Kinase 1/2) ELISA Kit
MBS7615426-01 48 Well

Mouse ERK1/2 (Extracellular Signal Regulated Kinase 1/2) ELISA Kit

Sign In for Pricing
View Details
Mouse ERK1/2 (Extracellular Signal Regulated Kinase 1/2) ELISA Kit
MBS7615426-02 96 Well

Mouse ERK1/2 (Extracellular Signal Regulated Kinase 1/2) ELISA Kit

Sign In for Pricing
View Details
Mouse ERK1/2 (Extracellular Signal Regulated Kinase 1/2) ELISA Kit
MBS7615426-03 5x 96 Well

Mouse ERK1/2 (Extracellular Signal Regulated Kinase 1/2) ELISA Kit

Sign In for Pricing
View Details