Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RSPO2 Protein

This Human RSPO2 Protein spans the amino acid sequence from region 22-205aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Roof plate-specific spondin-2) (hRspo2)

UniProt

Q6UXX9

Expression Region

22-205aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human CA724 (Tumor Marker CA724) ELISA Kit
E-UNEL-H0230-01 5x 96 Tests

Uncoated Human CA724 (Tumor Marker CA724) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CA724 (Tumor Marker CA724) ELISA Kit
E-UNEL-H0230-02 15x 96 Tests

Uncoated Human CA724 (Tumor Marker CA724) ELISA Kit

Sign In for Pricing
View Details
SensiStain™ Anti-AKR1B10 Antibody
HY000007 0.1 mL

SensiStain™ Anti-AKR1B10 Antibody

Sign In for Pricing
View Details
FBLN5 Antibody
8C15754-AAT 50 µg

FBLN5 Antibody

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (rCNN1/832), Biotin conjugate, 0.1mg/mL
BNCB1866-100 1x 100 µL

Calponin-1 (Smooth Muscle Marker) (rCNN1/832), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2674), CF640R conjugate, 0.1mg/mL
BNC402674-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2674), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details