Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFI35 Protein

This Human IFI35 Protein spans the amino acid sequence from region 2-286aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFP 35) (Ifi-35)

UniProt

P80217

Expression Region

2-286aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN4 Rabbit pAb
E45R17877N-100 100 µL

TSPAN4 Rabbit pAb

Sign In for Pricing
View Details
Human anti-human VEGF mAb (46)
E4A09D12-46-100-01 100 µg

Human anti-human VEGF mAb (46)

Sign In for Pricing
View Details
Human anti-human VEGF mAb (46)
E4A09D12-46-100-02 100 µg

Human anti-human VEGF mAb (46)

Sign In for Pricing
View Details
Kv4.2 Rabbit Polyclonal Antibody (Cy5)
orb958400 100 µL

Kv4.2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Mouse Anti-Triadimefon Monoclonal Antibody
VD2N471 1 Each

Mouse Anti-Triadimefon Monoclonal Antibody

Sign In for Pricing
View Details
SH2D3A Rabbit Polyclonal Antibody (PE-Cy5.5)
orb891091 100 µL

SH2D3A Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details