Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SNCB Protein

This Human SNCB Protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q16143

Expression Region

1-134aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clorazepate-d5 Ethyl Ester
CS-O-41653 1 Each

Clorazepate-d5 Ethyl Ester

Sign In for Pricing
View Details
HNF1a (Hepatocyte Nuclear Factor 1 Alpha) BioAssayTM ELISA Kit (Human) discontinued
383265 96 Tests

HNF1a (Hepatocyte Nuclear Factor 1 Alpha) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
MEKK1 Antibody (C-term)
orb1928775-01 50 µL

MEKK1 Antibody (C-term)

Sign In for Pricing
View Details
MEKK1 Antibody (C-term)
orb1928775-02 100 µL

MEKK1 Antibody (C-term)

Sign In for Pricing
View Details
PRX-08066 Maleic acid
T6959-01 1 mg

PRX-08066 Maleic acid

Sign In for Pricing
View Details
PRX-08066 Maleic acid
T6959-02 5 mg

PRX-08066 Maleic acid

Sign In for Pricing
View Details